Login| Sign Up| Help| Contact|

Patent Searching and Data


Matches 351 - 400 out of 839

Document Document Title
WO/1999/015549A2
Peptides of the formula (1) ?N¿TCPPCPXYCPPCPA?C¿ are described wherein X and Y, which may be the same or different, is each a neutral aliphatic L-amino acid residue, and protected and reactive derivatives thereof. The peptides may be u...  
WO1998054577A9
Methods for determining an optimal binding motif for a binding compound are provided in which the binding compound is contacted with an oriented degenerate cyclic peptide library (ODCPL) under conditions which allow for interaction betwe...  
WO/1998/027805A1
A new family of antimicrobial proteins is described. Prototype proteins can be isolated from $i(Macadamia integrifolia) as well as other plant species. DNA encoding the protein is also described as well as DNA constructs which can be use...  
WO/1998/017301A1
Peptides derived from shark immunoglobulin preparations are used to prepare compositions, including pharmaceutical compositions, for inhibiting retrovirus replication in susceptible cells. The peptide preparations are useful for inhibiti...  
WO/1998/009984A1
The present invention is directed to a central nervous system-derived heat stable immune privilege factor which exerts an inhibitory effect on macrophage migration and/or macrophage phagocytic activity. In addition, the factor exerts an ...  
WO/1998/009985A2
The present invention is directed to peptides of the formulas (i) Xaa - Yaa - Arg, wherein either Xaa is any amino acid residue and Yaa is Glu or Xaa is absent and Yaa is any amino acid residue with the exception of Pro; (ii) Arg - Yaa -...  
WO/1998/005348A1
This invention relates to amino acid sequences from within a consensus peptide of the formula: VEKNITVTASVDPTIDLLQADGSALPSAVALTYSPA (Seq. #1). Eight mer peptides from within the consensus peptide were tested against an antibody raised to...  
WO/1998/004278A2
The present invention provides antitumor peptides of formula (I): A-B-NR?3�-CHD-CH(OCH�3?)-CH�2?CO-E-K and the acid salts thereof. A is an amino acid residue selected from the group consisting of N-methyl-D-prolyl, N-methyl-D-homop...  
WO/1997/047644A1
The present invention provides peptides which affect T-cells, presumably by action on the T-cell antigen receptor. The present invention further relates to the therapy of various inflammatory and autoimmune disease states involving the u...  
WO/1997/046259A2
The present invention relates particularly to neoplastic cells targeted chimeric toxins comprising of cell targeting moieties and cell killing moieties for recognizing and for destroying the neoplastic cells, wherein the cell targeting m...  
WO/1997/038703A1
Disclosed is a chimeric isoprenoid synthase polypeptide including a first domain from a first isoprenoid synthase joined to a second domain from a second, heterologous isoprenoid synthase, whereby the chimeric isoprenoid synthase is capa...  
WO/1997/035969A2
Novel peptides that are capable of binding to uPAR and inhibiting the binding of an integrin and vitronectin are described. Also provided are nucleic acid sequences encoding the novel peptides. Methods for screening for small molecules, ...  
WO/1997/018827A1
The present invention provides methods and compositions suitable for treating oral mucositis in animals, including humans, with antimicrobial peptides such as protegrin peptides.  
WO/1997/018826A1
The invention is directed to antimicrobial peptides related to naturally-occurring protegrin peptides, and methods of using the peptides in a variety of contexts, including the treatment or prevention of infections.  
WO/1997/000081A1
A method of inhibiting the dissemination of bacteria into and from the bloodstream is described. The method is useful in the prevention of peritonitis and bacteremia.  
WO/1996/041188A1
The present invention provides peptides that bind to MHC class I molecules. The peptide has a core of 7 to 14 amino acids linked at either its N- or C- terminus to at least two amino acids. The terminal-most additional amino acid contain...  
WO/1996/032478A1
Polypeptides that are cleared from the kidney and do not contain in their original form an Fc region of an IgG are altered so as to comprise a salvage receptor binding epitope of an Fc region of an IgG and thereby have increased circulat...  
WO/1996/030514A1
Compounds and compositions for eliciting or enhancing immune reactivity to HER-2/neu protein are disclosed. The compounds include polypeptides and nucleic acid molecules encoding such peptides. The compounds may be used for the preventio...  
WO/1996/013590A2
The present invention relates to new genomic nucleotide sequences and amino acid sequences corresponding to the coding region of these genomes. The invention relates to new HCV types and subtypes sequences which are different from the kn...  
WO/1996/013592A2
The present invention relates to a DNA sequence encoding a neuronal protein kinase (NPK) which phosphorylates tau proteins as well as other microtubule associated proteins (MAPs) in positions crucial for the binding to microtubules. The ...  
WO/1995/031474A1
The invention features novel peptide derivatives called Reversins, and provides for their use in a method of reducing the activity of the multi-drug transporter protein MDR1 in order to overcome multidrug resistance in a mammal. The pept...  
WO/1995/023812A1
Novel antibiotic stalobacins H and I having physico-chemical properties as shown in Table 1 are provided, which are excellent antibiotics showing marked effects on Gram-positive bacteria.  
WO/1995/017412A1
DNA encoding a novel human 'beta'2 integrin 'alpha' subunit polypeptide, designated 'alpha'd, is disclosed along with methods and materials for production of the same by recombinant procedures. Fusion proteins are also disclosed which in...  
WO/1995/007354A1
Peptides are described which elicit antibodies, preferably including secretory antibodies secreted by mucosal surfaces, that show neutralizing activity against different strains and clinical isolates of HIV-1 and that inhibit the fusion ...  
WO/1995/006662A1
A neuron regulatory factor (NRF), derived from cells of the central nervous system, is provided. NRF comprises a large polypeptide or complex of polypeptides that is antigenically distinct from several other known neurotrophic or neuron ...  
WO/1994/026294A1
Compositions and methods of incorporating ligand precursors and ligands at any location within a peptide during peptide synthesis are disclosed. Derivatives of 2,4,5-triaminopentanoic acid and gamma-aminoglutamic acid are selectively inc...  
WO/1994/007448A1
Methods are provided for preparing compositions suitable for protecting irritated or damaged skin from further oxidative and biochemical damage and thus permitting natural healing processes to progress, for accelerating the rate of heali...  
WO/1994/008018A1
Disclosed is a biologically functional altered polypeptide, comprising fewer amino acids and being reduced in size compared with the unaltered polypeptide, wherein the altered polypeptide lacks at least part of a loop region which is pre...  
WO/1994/004678A1
The invention relates to isolated immunoglobulin, characterized in that it comprises two heavy polypeptide chains sufficient for the formation of a complete antigen binding site or several antigen binding sites, this immunoglobulin being...  
WO/1994/003196A1
A therapeutical or diagnosing agent contains as active substance at least one nucleic acid which hybridises with a pax gene, or atleast a pax protein, or at least one antibody against a pax protein or one of its derivates. These agents a...  
WO/1993/025670A1
The present invention provides the identification and characterization of two components of a recombinant preparation of DNase. These components are the purified deamidated and non-deamidated human DNases. Taught herein are the separatio...  
WO/1993/025583A2
Improved proteinoid carriers and methods for their preparation and use as oral delivery systems for pharmaceutical agents are described. The proteinoid carriers are soluble within selected pH ranges within the gastrointestinal tract and ...  
WO/1993/021223A1
A number of octapeptides were generated from the sequences encoding the 60 kDa Ro/SSA peptide, the La/SSB autoantigen, the 70 kD nuclear ribonucleoprotein (nRNP), and the Sm B/B' polypeptide, which represent linear epitopes for autoantib...  
WO/1993/016087A2
Novel Amadori reaction compounds have the formula R¿1?-NH-R¿2?, wherein R¿1? comprises the D-form of a 1-amino-1-deoxy-2-ketose radical derived from a sugar radical selected from the group of glucose, xylose, galactose, rhamnose, fruc...  
WO/1993/012777A1
Methods for regulating cation transport across cellular membranes possessing cation channels are provided. The cell membrane possessing a specific ion channel is exposed to a non-aromatic polyamine compound having a lysine- or arginine-b...  
WO/1993/013127A1
The invention concerns peptides which react immunochemically with antibodies directed against HCV and nucleic acid sequences encoding these peptides. A method for the detection of HCV or anti-HCV antibodies in a test fluid, an immunochem...  
WO/1993/004077A1
Novel fluorescent precipitating substrates made from a class of fluorophores, generally including quinazolinones (quinazolones), benzimidazoles, benzothiazoles, benzoxazoles, quinolines, indolines, and phenanthridines, having general for...  
WO/1993/002708A1
Novel oligopeptides are disclosed for in vivo tumour imaging and therapy. The novel oligopeptides are oligopeptides containing from 4 to 50 peptide units containing as a characteristic triplet therein the amino acid sequence leu-asp-val ...  
WO/1993/000365A2
HCV epitopes useful as immunogenic reagents, and corresponding antibodies and methods of use are disclosed.  
WO/1992/020647A1
The invention relates to lipopolyaminoacids consisting of a mixture of amino acids obtained by total hydrolysis of a protein issued from oil plant expellers, said amino acids being N-acylated by a C4-C30 acyl radical, as well as a proces...  
WO/1992/017608A1
A process for detecting the invasiveness and differentiation of tumor cells of epithelial origin in which the expression of the superficial antigen E-cadherin in tumour cells is investigated on the protein plane, especially by monoclonal...  
WO/1992/010197A1
Substances of polypeptide nature obtainable by extraction from animal tissue homogenates, which substances can induce, when administered to various animal species, the formation of antibodies able to recognize $i(in vivo) or $i(in vitro)...  
WO/1992/004910A1
The invention provides methods for obtaining substantially purified high and low molecular weight Na-K-ATPase inhibitor compounds having natriuretic and vasoconstrictive activity, antibodies reactive with the compounds and methods for th...  
WO/1992/004446A1
Recombinant genetic information (DNA or RNA), comprising a Chicken Anaemia Virus (CAV)-specific nucleotide sequence and the use thereof for diagnostics, vaccination or protein production. Recombinant CAV protein and the use thereof for d...  
WO/1991/018980A1
Methods and compositions are described for producing a random peptide library for identifying molecules that have biological activity, and that would have applications in the clinical setting as prophylactics and/or therapeutics.  
WO/1991/012274A1
The bacterial peptide fraction with immunostimulatory effect may be obtained from commensalic or symbiotic micro-organisms belonging to the physiological microflora of the digestive tract, the skin or the respiratory tract of humans and ...  
WO/1991/000915A1
The present invention uses aerosol beam technology to accelerate either wet or dry aerosol particles to speeds enabling the particles to penetrate living cells. Aerosol particles suspended in an inert gas are accelerated to a very high v...  
WO/1991/000356A1
The invention described herein encompasses a method of influencing the metabolic stability of an intracellular protein in vivo (in intact cells and whole animals) along with compositions for affecting such regulation. The method comprise...  
WO/1989/011475A1
The invention is a chelate having general formula (I), wherein R1-4 is -CH2COOH; n is 1 to 5; X is a member selected from the group consisting of -NO2, -NH2, -NCS, -NHCOCH2-Z with Z being a member selected from the group consisting of Br...  
WO/1989/007608A1
A calcium channel composition is isolated from neuronal cell membranes by hydrophobic affinity chromatography. The affinity adsorbent used in the isolation technique is a calcium channel blocking factor derived from the venom of funnel w...  

Matches 351 - 400 out of 839