| Document |
Document Title |
|
WO/2024/097206A1 |
The present invention relates to Compound (A), pharmaceutically acceptable salts thereof, methods of making, and use thereof optionally in combination with one or more additional therapeutic agents for the treatment of disease.
|
|
WO/2024/036207A3 |
The invention provides antibodies, antibody fragments or antigen-binding fragments, as well as related antibody drug conjugates (ADCs) and chimeric antigen receptors (CARs), that specifically recognize a multiple myeloma cell surface ant...
|
|
WO/2024/097868A1 |
This disclosure relates to the structure-- activity relationships for 4-phosphoryloxy-N,N-dimethyltryptamine (psilocybin), 4-phosphoryloxy-N-methyltryptamine (baeocystin), and 4-phosphoryloxy-N,N,N-trimethyltryptamine (aeruginascin), as ...
|
|
WO/2024/098009A1 |
Compositions and methods for treating or preventing a condition related to myocardial infarction and infarct expansion, extension, and/or dilation following a cardiovascular disorder incident (e.g., post-myocardial infarction) using an e...
|
|
WO/2024/095279A1 |
The present invention discloses synergistic herbal compositions comprising combination of a first ingredient selected from Centella asiatica extract containing at least one component selected from magnesium salt or complex of asiatic aci...
|
|
WO/2024/096133A1 |
The present invention provides a cell-to-cell human T-lymphotropic virus type 1 (HTLV-1) infection inhibitor that contains a substance that inhibits interaction between N-acetyllactosamine (LacNAc) and galectin-3 (Gal-3).
|
|
WO/2024/095992A1 |
The present invention addresses the problem of providing a novel means for suppressing renal hypofunction, the means being capable of fundamentally improving diseases associated with renal hypofunction, including chronic kidney disease (...
|
|
WO/2024/097653A1 |
Methods for treatment of myeloproliferative neoplasms are provided, particularly in patients with poor bone marrow functioning, and difficult to treat human patients such as those with relapsed or refractory disease. The disclosed method...
|
|
WO/2024/097721A1 |
The disclosure relates to the use of inhibitors of phosphoinositide 3-kinase (PI3K) that target allosteric and orthosteric pockets of PI3K in methods of treating, preventing, or ameliorating a disease, or disorder, (or uses in the treatm...
|
|
WO/2024/064807A3 |
The present disclosure provides methods of treating a medulloblastoma in a subject in need comprising administering T3 to the subject. The present disclosure also provides methods of inhibiting proliferation of medulloblastoma cells in a...
|
|
WO/2024/097908A1 |
The present invention is generally directed to a potent therapy for SARS-CoV-2 (CoV2) disease which involve combinations of agents. Here we describe combinations of 2 drugs wherein the combination inhibits CoV2 replication through one or...
|
|
WO/2024/059753A3 |
This disclosure relates to the once weekly dosing regimen of a dual GLP-1R and GCGR agonist, formulations, and methods of using the same for inducing weight loss in a human being with fatty liver disease, wherein the human may or may not...
|
|
WO/2024/097636A1 |
This disclosure provides compounds of Formula (I), and pharmaceutically acceptable salts thereof, that inhibit phosphatidylinositol 4,5-bisphosphate 3-kinase (PI3K) isoform alpha (PI3Kα) for use in combination with additional therapeuti...
|
|
WO/2024/095118A1 |
The present invention relates to dosing regimens of CSF-1R inhibitors for treating amyotrophic lateral sclerosis. More particularly, the present invention relates to a CSF-1R inhibitor for use in the treatment of amyotrophic lateral scle...
|
|
WO/2024/097804A1 |
The present application provides methods of treating a cancer in an individual that involves administering to the individual a tyrosine kinase inhibitor and a pro-inflammatory agent (such as a TLR agonist, a STING activator, a radiation ...
|
|
WO/2024/094844A1 |
The present disclosure relates to oral formulations of an n-pyridinyl acetamide derivative, and the use of such formulations in the treatment of interstitial lung diseases.
|
|
WO/2024/098005A1 |
This present invention provides a pharmaceutical composition comprising one or more ACAT inhibitors and one or more GLP-lRAs. It also provides a method for controlling body weight comprising co-administering to a subject in need one or m...
|
|
WO/2024/097878A1 |
Provided herein are methods of predicting a risk of developing an immune-related adverse event (irAE) from an immune checkpoint inhibitor (ICI) therapy. The methods include the classification of T cell receptor p genes as productive TCRÎ...
|
|
WO/2024/036235A3 |
Provided are proteins and protein-based sensors for detecting MnII. The proteins may have the following sequence: Z1-MPTTTTKVDIAAFDPDKDGTIHLKDALAAGSAAFDKLDPDKDGTLHAKDLKGRVSEA
DLKKLDPDX1DGTLHKKDYLAAVEAQFKAAX2PDNDGTIX3ARX4LASPAGSALVNLIR-
X...
|
|
WO/2024/096122A1 |
The present disclosure provides a microbiome for the purpose of improving the response rate of an immune checkpoint inhibitor. Specifically, the present disclosure provides a microorganism wherein at least one gene among a flagella-formi...
|
|
WO/2024/091299A1 |
Described herein are methods for disease or disorder associated with GABA transporter 1 (GAT-1) dysfunction. In one aspect described herein, the disease or disorder is associated with one or more solute carrier Family 6 Member 1 (SLC6A1)...
|
|
WO/2024/089702A1 |
The present invention relates to an improved process for the preparation of (N4-(4-([1,2,4]triazolo[1,5-a]pyridin-7-yloxy)-3-methylpheny
l)-N6-(4,4-dimethyl-4,5-dihydrooxazol-2-yl)quinazoline-4,6-d
iamine compound of formula-1 and its sa...
|
|
WO/2024/088309A1 |
Provided are a multispecific antibody binding to GPRC5D and CD3 antigens, an antigen binding molecule thereof, a nucleic acid molecule encoding the multispecific antibody and the antigen binding molecule thereof, a vector containing the ...
|
|
WO/2024/092205A1 |
The general field of the present disclosure are novel approaches to the treatment of Alzheimer's and other neurodegenerative disorders using novel therapeutics comprising SHIP1 phosphatase inhibitors. Specifically, the invention provides...
|
|
WO/2024/089247A1 |
The present invention relates to a compound for treatment of neuropathic pain. It also relates to pharmaceutical compositions thereof, as well as methods of treatment of neuropathic pain.
|
|
WO/2024/087673A1 |
An antiplatelet drug, comprising a platelet inhibitory molecule, a linker, and a capture group. The capture group is a functional group of click chemistry reaction. The antiplatelet drug has good antiplatelet activity, and can be used in...
|
|
WO/2024/092269A1 |
The present invention relates to pharmaceutical formulations for kratom extract and mitragynine, which is the major alkaloid extracted from kratom, and use methods thereof for treatment of osteoarthritis in canine subjects.
|
|
WO/2024/090329A1 |
The present inventors have found that a pyridoxal synthetic enzyme Pyridoxamine-5'-phosphate oxidase (PNPO) acts as an oxygen sensing mechanism for a novel pathway that is independent from an HIF pathway in chronic hypoxia. A pharmaceuti...
|
|
WO/2024/092240A1 |
The present disclosure relates to the use of an endothelin receptor antagonist, or a pharmaceutically acceptable salt thereof, and isolated antibodies, including antigen-binding fragments thereof, which bind human APRIL for the treatment...
|
|
WO/2024/006460A9 |
Biomarkers and machine learning techniques to identify biomarkers are disclosed herein. In one particular implementation, the present disclosure relates to the identification of biomarkers to be used in the detection and diagnosis of LD....
|
|
WO/2024/088712A1 |
The present invention relates to mGluR5 antagonists, or compounds 4-[5-[(rac)-1-[5-(3- Chlorophenyl)-3-isoxazolyl]ethoxy]-4-methyl-4H-1,2,4-triazol
-3-yl]pyridine (TT00), or a pharmaceutically acceptable salt thereof, enantiomer, isotope...
|
|
WO/2024/089013A1 |
The invention relates to a combination of a PARP inhibitor with Omomyc, a functionally equivalent variant thereof, a conjugate comprising Omomyc or said functionally equivalent variant, a polynucleotide encoding said polypeptides, a vect...
|
|
WO/2024/090571A1 |
Provided are: a method for detecting immune-mediated inflammatory diseases characterized by an increase in the expression of MMP12 in a subject; a diagnostic drug containing a substance that specifically interacts with MMP12; and a thera...
|
|
WO/2024/089046A1 |
The present invention relates to a pharmaceutical composition suitable for an intra-articular injection comprising an anesthetic agent and an immediate or controlled release dosage form comprising colchicine. It further relates to a phar...
|
|
WO/2024/091863A1 |
Therapies and regimens for treating chronic diseases, disorders, and conditions that have a plurality of intervention targets and/or therapeutic targets are provided. Therapies include administration combinatorial regimens, and administr...
|
|
WO/2024/046471A9 |
The present application provides a class of novel compounds having a USP1 inhibitory activity as shown in formula (II'), pharmaceutical compositions comprising the compounds, useful intermediates for preparing the compounds, and a method...
|
|
WO/2024/090521A1 |
Provided is a pharmaceutical composition for treating and/or preventing renal cystic ciliopathy, the composition containing a retinoic acid receptor (RAR) agonist.
|
|
WO/2024/091624A1 |
Pharmaceutical formulations, particularly solid oral dosage forms (e.g., tablets) comprising (i) the compound of Formula I in an amount of about 40 wt% to about 70 wt%, (ii) a filler, (iii) a disintegrating agent, (iv) and a lubricant ar...
|
|
WO/2024/087265A1 |
A protein inhibitor, a reagent set, and a use thereof. The protein inhibitor is an inhibitor for inhibiting a CILK1 protein; the protein inhibitor is CILK1-C28 or CILK1-C30; the use of the protein inhibitor is to apply the protein inhibi...
|
|
WO/2024/091484A1 |
Disclosed are synthetic amniotic fluid compositions comprising ulin-A- statin/urinary trypsin inhibitor (UTI) and ascorbic acid and methods of using the disclosed synthetic amniotic fluid compositions, which may be useful for a variety o...
|
|
WO/2024/084435A2 |
The present invention relates to a viscous liquid ophthalmic composition comprising or, alternatively, consisting of natural gums and extracts, in particular at least one mucilage and at least one hydrocolloid, useful, for example, as a ...
|
|
WO/2024/086194A1 |
The present disclosure describes methods of treating a subject suffering from cancer using a combination therapy comprising (i) administering to the subject a therapeutically-effective amount of a compound that blocks SUMOylation in the ...
|
|
WO/2024/085245A1 |
The purpose of the present invention is to provide a preparation that can effectively suppress post-operative delirium. A post-operative delirium suppressant according to the present invention is characterized by containing a GABA-A rece...
|
|
WO/2024/083221A1 |
A mucosal administration formulation, and a preparation method and use therefor. The preparation method for the mucosal administration formulation comprises the following steps: (1) mixing a nucleating agent solution, a drug protein solu...
|
|
WO/2024/084212A1 |
The present invention relates to a compound for use in a method of treating idiopathic pulmonary fibrosis in a patient, which compound is ensifentrine or a pharmaceutically acceptable salt thereof, wherein the method comprises administer...
|
|
WO/2024/085166A1 |
The present invention addresses the problem of: providing an anti-CLDN4-anti-CD137 bispecific antibody to be used in combination with a PD-1 signal inhibitor for treatment of a cancer, or a pharmaceutical composition comprising said bisp...
|
|
WO/2024/086316A1 |
A method of treating a cancer having one or more mutations in tumour suppressors AXIN1 and/or APC in the WNT pathway in a subject in need thereof is provided wherein the method comprises administering a MEK inhibitor or a pharmaceuticall...
|
|
WO/2024/086634A1 |
The application relates to heterocyclic heteroaromatic macrocyclic ether compounds of the general Formula (I), pharmaceutically acceptable salts of the compounds and pharmaceutical compositions thereof. The compounds act as selective inh...
|
|
WO/2024/083176A1 |
Disclosed are the uses of amniotic fluid in the preparation of a drug for treating and/or preventing macrophage-mediated diseases, a drug for treating and/or preventing type M1 macrophage-mediated diseases, a drug for treating and/or pre...
|
|
WO/2024/086577A1 |
The present disclosure features methods useful for the treatment of BAF complex-related cancers.
|
